HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P7K008",
"id": "A0A6P7K008_9TELE",
"source_organism": {
"taxId": "210632",
"scientificName": "Parambassis ranga",
"fullName": "Parambassis ranga (Indian glassy fish)"
},
"name": "non-specific serine/threonine protein kinase",
"description": [
"Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine. The complex is probably involved in the transfer of the threonylcarbamoyl moiety of threonylcarbamoyl-AMP (TC-AMP) to the N6 group of A37. TP53RK has ATPase activity in the context of the EKC/KEOPS complex and likely plays a supporting role to the catalytic subunit OSGEP. Atypical protein kinase that phosphorylates 'Ser-15' of p53/TP53 protein and may therefore participate in its activation"
],
"length": 228,
"sequence": "MALPDFLSKDKLIKQGAEARVYRAEFLGKPAIVKERFPKRYRHPALDEKLTHRRTTQEVRSILRCRKAGISVPVVYFVDYTSHCIFLEEITGSLTVSDYIASIQQCKEQELLRLAEQVGQILAKMHDEDVIHGDLTTSNMLLRCSTVDIHQTDLVLIDFGLSYISALPEDKGVDLYVLEKAFLSTHPNTEVLFRKLLEGYAASSKKSPAVIKKLDEVRLRGRKRSMVG",
"proteome": "UP000515145",
"gene": "tp53rk",
"go_terms": [
{
"identifier": "GO:0004672",
"name": "protein kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006468",
"name": "protein phosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004674",
"name": "protein serine/threonine kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1a5aef97ef5001f4e0f71c8229f6da9cfadb22cb",
"counters": {
"domain_architectures": 12757,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"profile": 1,
"ssf": 1,
"cathgene3d": 2,
"panther": 1,
"ncbifam": 1,
"pfam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 12757
}
}
}