GET /api/protein/UniProt/A0A6P7JWQ0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P7JWQ0",
        "id": "A0A6P7JWQ0_9TELE",
        "source_organism": {
            "taxId": "210632",
            "scientificName": "Parambassis ranga",
            "fullName": "Parambassis ranga (Indian glassy fish)"
        },
        "name": "Thioredoxin-interacting protein",
        "description": [
            "May act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. Interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. Functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. Required for the maturation of natural killer cells. Acts as a suppressor of tumor cell growth. Inhibits the proteasomal degradation of DDIT4, and thereby contributes to the inhibition of the mammalian target of rapamycin complex 1 (mTORC1)"
        ],
        "length": 401,
        "sequence": "MVLSPVNKMKVFRLQLSDSGRSFYCSGDKLSGSVQLEAAQPCRLAGLRVTAAGCARVVHRSGKNRKSRSQEVEYLKYEEEVRLDEVLSQGSDGFFLLQXCXTFSFQFGFELPPPGRLVSSYKGKFGSVRYYVLGELQQPSQRALQCEREFEVEEPLDVNQADLLAPAAASKQKKVTCMFIPDGQVSISAQIDRKGFCEGEDININAKFENTCSRIVIPKAAIIATHSYVTDGHTKVQRQKLSAVRGNHIISGMCDMWQGKTIRVPKLKPTLLGCDIIKVDYTLMIYLSIPGSEKLILELPLVIGTIPFSGVGSRTSSMSSQADSMSSWSSFPSAPPSYSNIHRDLRVEGPRTPLLHDYDDGEDREDGGLFMRAPELYYPPPPAYSEVDGDSADPPQTVQVF",
        "proteome": "UP000515145",
        "gene": "LOC114448559",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "59e7dc3418e2699290ec55cb5102b7cea0ac7128",
        "counters": {
            "domain_architectures": 23199,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "smart": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 23199
        }
    }
}