GET /api/protein/UniProt/A0A6P7JWQ0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P7JWQ0",
"id": "A0A6P7JWQ0_9TELE",
"source_organism": {
"taxId": "210632",
"scientificName": "Parambassis ranga",
"fullName": "Parambassis ranga (Indian glassy fish)"
},
"name": "Thioredoxin-interacting protein",
"description": [
"May act as an oxidative stress mediator by inhibiting thioredoxin activity or by limiting its bioavailability. Interacts with COPS5 and restores COPS5-induced suppression of CDKN1B stability, blocking the COPS5-mediated translocation of CDKN1B from the nucleus to the cytoplasm. Functions as a transcriptional repressor, possibly by acting as a bridge molecule between transcription factors and corepressor complexes, and over-expression will induce G0/G1 cell cycle arrest. Required for the maturation of natural killer cells. Acts as a suppressor of tumor cell growth. Inhibits the proteasomal degradation of DDIT4, and thereby contributes to the inhibition of the mammalian target of rapamycin complex 1 (mTORC1)"
],
"length": 401,
"sequence": "MVLSPVNKMKVFRLQLSDSGRSFYCSGDKLSGSVQLEAAQPCRLAGLRVTAAGCARVVHRSGKNRKSRSQEVEYLKYEEEVRLDEVLSQGSDGFFLLQXCXTFSFQFGFELPPPGRLVSSYKGKFGSVRYYVLGELQQPSQRALQCEREFEVEEPLDVNQADLLAPAAASKQKKVTCMFIPDGQVSISAQIDRKGFCEGEDININAKFENTCSRIVIPKAAIIATHSYVTDGHTKVQRQKLSAVRGNHIISGMCDMWQGKTIRVPKLKPTLLGCDIIKVDYTLMIYLSIPGSEKLILELPLVIGTIPFSGVGSRTSSMSSQADSMSSWSSFPSAPPSYSNIHRDLRVEGPRTPLLHDYDDGEDREDGGLFMRAPELYYPPPPAYSEVDGDSADPPQTVQVF",
"proteome": "UP000515145",
"gene": "LOC114448559",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "59e7dc3418e2699290ec55cb5102b7cea0ac7128",
"counters": {
"domain_architectures": 23199,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"smart": 1,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 23199
}
}
}