General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P7HJG8",
        "id": "A0A6P7HJG8_9TELE",
        "source_organism": {
            "taxId": "210632",
            "scientificName": "Parambassis ranga",
            "fullName": "Parambassis ranga (Indian glassy fish)"
        },
        "name": "Matrilin-1",
        "description": [
            "A major component of the extracellular matrix of non-articular cartilage. Binds to type 2 collagens and forms long concatenated protein networks as part of the extracellular matrix. Required for the network-like organization and bundling of collagen fibrils surrounding chondrocytes in the zones of maturation and hypertrophy. Required for mechanotransduction and adaption to mechanical loading in cartilage chondrocytes, resulting in an increase in expression of the extracellular matrix components ACAN and COL2A1. Acts as a moderator of angiogenesis in response to injury"
        ],
        "length": 448,
        "sequence": "MTPTLPLFLLLLGLMGAQATVDLRTAAAMAAGLCKTRPTDLVFIIDSSRSVRPAEFEQVKVFLAKVIEGLDVGPNATRVGVVNYASRVKNEVSLKTHRTKAGLVKAVTKIEPLSTGTMTGLAIQFSLNVAFSEGEGARSKPEISKVAIIVTDGRPQDNVKEVAQRARDAGIEIFAIGVGRVDMSTLRQMASDPLDDHVDYVESYSVIEKLTKKFQEAFCACGNAATDVVFLIDGSKSVRPENFELVKKWINQIIDKLDVSESKTHVGLVQYSSSVRQEFPLGRYNNKKDLKEAVKKMAYMEKGTMTGQALRHMTENSFSPGQGARPGVTKVGIVFTDGRSQDYIGDAAKKAKDSGFKMYAVGVGNAVEDELKEIASEPIGEHYFYTADFKTMNQIAKKLQINICQEEDPCECDSLVKFQKKVEDALQALTKKLESMSKRIALLENKIV",
        "proteome": "UP000515145",
        "gene": "matn1",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ad1304ad4cad12a9e3af369e2dd5360ec87f966d",
        "counters": {
            "domain_architectures": 123,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "smart": 2,
                "cathgene3d": 2,
                "pfam": 2,
                "profile": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 123
        }
    }
}