GET /api/protein/UniProt/A0A6P7F1Q1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P7F1Q1",
"id": "A0A6P7F1Q1_DIAVI",
"source_organism": {
"taxId": "50390",
"scientificName": "Diabrotica virgifera virgifera",
"fullName": "Diabrotica virgifera virgifera (western corn rootworm)"
},
"name": "Fibrinogen C-terminal domain-containing protein",
"description": [
"Lectin involved in innate immunity. Agglutinates all types of human erythrocytes, Gram-positive and Gram-negative bacteria. Has a stronger agglutinating activity towards Gram-negative bacteria than towards Gram-positive bacteria. Specifically recognizes acetyl group-containing substances on agglutinated cells. The hemagglutinating activity was inhibited by EDTA, acetyl group-containing mono- and disaccharides, N-acetyl derivatives of amino acids, other acetyl group-containing substances, propionamide and benzamide. Enhances the antimicrobial activity of big defensin against Gram-positive bacteria but not against Gram-negative bacteria"
],
"length": 347,
"sequence": "MIFLSLFALVSVALAEYQILGRAEEHNPVNVKLTKLLDVKVESKADSWKNDFSRFFQPQSDEISLGRKDEHNVQIPLKLSLGVEQSGVNEDYSQNFFSIFKKCKSLVGRSKTPICHLNPLPEYSDKYNAYPGSCREILDNVSNKTGIYTIKPRTSKKPFSVLCDMETKGGGWTYIQKRFDGSQEFYLGYKDYKFGFGDLNGEFWIGLENIHHMTGSEINELLIELTDRDKKTAYAQFKTFGIGPEKDGYILNVLTGYSGDAGDALSPHLNSKFSTFDVDQDENPGNCAVIHEGAWWYKACHTSNLNGKHINVNLSATYNYHGVNWNGFRGHLYILAGSKMMIRAVEV",
"proteome": null,
"gene": "LOC114324253",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "773c1c4bd0ba3f4a7d67718754a692a4fd7e8b22",
"counters": {
"domain_architectures": 32923,
"entries": 14,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"smart": 1,
"cdd": 1,
"ncbifam": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 32923
}
}
}