General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P7F1Q1",
        "id": "A0A6P7F1Q1_DIAVI",
        "source_organism": {
            "taxId": "50390",
            "scientificName": "Diabrotica virgifera virgifera",
            "fullName": "Diabrotica virgifera virgifera (western corn rootworm)"
        },
        "name": "Fibrinogen C-terminal domain-containing protein",
        "description": [
            "Lectin involved in innate immunity. Agglutinates all types of human erythrocytes, Gram-positive and Gram-negative bacteria. Has a stronger agglutinating activity towards Gram-negative bacteria than towards Gram-positive bacteria. Specifically recognizes acetyl group-containing substances on agglutinated cells. The hemagglutinating activity was inhibited by EDTA, acetyl group-containing mono- and disaccharides, N-acetyl derivatives of amino acids, other acetyl group-containing substances, propionamide and benzamide. Enhances the antimicrobial activity of big defensin against Gram-positive bacteria but not against Gram-negative bacteria"
        ],
        "length": 347,
        "sequence": "MIFLSLFALVSVALAEYQILGRAEEHNPVNVKLTKLLDVKVESKADSWKNDFSRFFQPQSDEISLGRKDEHNVQIPLKLSLGVEQSGVNEDYSQNFFSIFKKCKSLVGRSKTPICHLNPLPEYSDKYNAYPGSCREILDNVSNKTGIYTIKPRTSKKPFSVLCDMETKGGGWTYIQKRFDGSQEFYLGYKDYKFGFGDLNGEFWIGLENIHHMTGSEINELLIELTDRDKKTAYAQFKTFGIGPEKDGYILNVLTGYSGDAGDALSPHLNSKFSTFDVDQDENPGNCAVIHEGAWWYKACHTSNLNGKHINVNLSATYNYHGVNWNGFRGHLYILAGSKMMIRAVEV",
        "proteome": null,
        "gene": "LOC114324253",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "773c1c4bd0ba3f4a7d67718754a692a4fd7e8b22",
        "counters": {
            "domain_architectures": 32923,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "smart": 1,
                "cdd": 1,
                "ncbifam": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 32923
        }
    }
}