GET /api/protein/UniProt/A0A6P6R9S3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P6R9S3",
        "id": "A0A6P6R9S3_CARAU",
        "source_organism": {
            "taxId": "7957",
            "scientificName": "Carassius auratus",
            "fullName": "Carassius auratus (Goldfish)"
        },
        "name": "Diphosphomevalonate decarboxylase",
        "description": [
            "Catalyzes the ATP dependent decarboxylation of (R)-5-diphosphomevalonate to form isopentenyl diphosphate (IPP). Functions in the mevalonate (MVA) pathway leading to isopentenyl diphosphate (IPP), a key precursor for the biosynthesis of isoprenoids and sterol synthesis"
        ],
        "length": 335,
        "sequence": "MNMTENDKQSLSMVTCTAPVNIAVIKYWGKRDEDLILPINSSLSITLHQDQLKTTTTIACSRNFQQDRIWLNGKEEDISNPRLQSCLQEIRRFSRKRRNSGDSTSDVSSVSHKVHICSVNNFPTAAGLASSASGYACLVYTLSQLFGVESEQLSAVARQGSGSACRSLYGGFVQWKLGEQLDGKDSLAEQVESESFWPELRILILVVSAEQKSVGSTSGMHTSVETSQLLKVAYTFDAGPNAVIYTLQDHLPEFVQVVRHFFPPEVNGEEFVKGLPVCSADLSEELKRDINMEPTPKGIRYIISTKAGPGPCVVKDPNHHLLGADGLPKKSAISD",
        "proteome": "UP000515129",
        "gene": "mvda",
        "go_terms": [
            {
                "identifier": "GO:0016831",
                "name": "carboxy-lyase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008299",
                "name": "isoprenoid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004163",
                "name": "diphosphomevalonate decarboxylase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0019287",
                "name": "isopentenyl diphosphate biosynthetic process, mevalonate pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005829",
                "name": "cytosol",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0c26d350e87e1863f06d8f8e4c843129e49d6074",
        "counters": {
            "domain_architectures": 8415,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8415
        }
    }
}