GET /api/protein/UniProt/A0A6P6QXB0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P6QXB0",
        "id": "A0A6P6QXB0_CARAU",
        "source_organism": {
            "taxId": "7957",
            "scientificName": "Carassius auratus",
            "fullName": "Carassius auratus (Goldfish)"
        },
        "name": "Large ribosomal subunit protein mL44",
        "description": [
            "Component of the 39S subunit of mitochondrial ribosome. May have a function in the assembly/stability of nascent mitochondrial polypeptides exiting the ribosome"
        ],
        "length": 332,
        "sequence": "MAACRALVSRAVLPLHFHNVCRGVMLTHIREKKRWMKAYTLIMERKRKMEGPPPPKQRSQQPNFDYNAEVEAFSARLQESFSMELLKTAFVNTCYLRSEEERRLALGLDLETTALNLKDNGELCVHGQQFTKGFLNDWCRGSFPSLPEEGVAAVVGHLTGSEVMCHVARNLALEDLTMSAEFPVPDETLQGTFFAVIGALEQSSGPVRAGLFIRDFLVSQLIGKDLFDMWKVVDPMGLLVKELTRKGIGLPEPRLIRSAGASTVLPLYFIGLYSECKLLAQGPGETVLAAEEEAARVALRKLYGFTENRRPWDFTAPGEKLQKPSVQALTSG",
        "proteome": "UP000515129",
        "gene": "mrpl44",
        "go_terms": [
            {
                "identifier": "GO:0004525",
                "name": "ribonuclease III activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006396",
                "name": "RNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003725",
                "name": "double-stranded RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "69ed2c472e97ed6c19a89b33b1f73992200a63f8",
        "counters": {
            "domain_architectures": 1656,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1656
        }
    }
}