GET /api/protein/UniProt/A0A6P6QGE6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P6QGE6",
"id": "A0A6P6QGE6_CARAU",
"source_organism": {
"taxId": "7957",
"scientificName": "Carassius auratus",
"fullName": "Carassius auratus (Goldfish)"
},
"name": "RING-type domain-containing protein",
"description": [
"Component of Polycomb group (PcG) multiprotein complexes; the complex class is required to maintain the transcriptionally repressive state of some genes"
],
"length": 235,
"sequence": "MTSHRKHLVRDFNFFITCYICKGYLIKPTTVTECLHTFCKSCIVQHFEDSNDCPKCGIQVHETNPLEMLRLDNTLEEVIFKLVPGLRKKEQLQEIEFWRRNKSKESPDEDGPICKKARLDEDDDVRCDRDYHRSDPQIAICLDCLRNNGQMGENIVKGLLKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEIMGKDHTMEFIYMTRWRLRGENAYPMVLEYRPRIDFG",
"proteome": "UP000515129",
"gene": "LOC113111703",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5be2b93f74851266da258b611f3d2a929a6fd262",
"counters": {
"domain_architectures": 7472,
"entries": 16,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"cdd": 2,
"ssf": 1,
"pfam": 2,
"profile": 1,
"smart": 1,
"panther": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 7472
}
}
}