General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P6QGE6",
        "id": "A0A6P6QGE6_CARAU",
        "source_organism": {
            "taxId": "7957",
            "scientificName": "Carassius auratus",
            "fullName": "Carassius auratus (Goldfish)"
        },
        "name": "RING-type domain-containing protein",
        "description": [
            "Component of Polycomb group (PcG) multiprotein complexes; the complex class is required to maintain the transcriptionally repressive state of some genes"
        ],
        "length": 235,
        "sequence": "MTSHRKHLVRDFNFFITCYICKGYLIKPTTVTECLHTFCKSCIVQHFEDSNDCPKCGIQVHETNPLEMLRLDNTLEEVIFKLVPGLRKKEQLQEIEFWRRNKSKESPDEDGPICKKARLDEDDDVRCDRDYHRSDPQIAICLDCLRNNGQMGENIVKGLLKKFIRCSTRVTVGTIKKFLSLKLKLPSSYELDVLCNGEIMGKDHTMEFIYMTRWRLRGENAYPMVLEYRPRIDFG",
        "proteome": "UP000515129",
        "gene": "LOC113111703",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5be2b93f74851266da258b611f3d2a929a6fd262",
        "counters": {
            "domain_architectures": 7472,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 2,
                "ssf": 1,
                "pfam": 2,
                "profile": 1,
                "smart": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7472
        }
    }
}