GET /api/protein/UniProt/A0A6P6LUG4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P6LUG4",
        "id": "A0A6P6LUG4_CARAU",
        "source_organism": {
            "taxId": "7957",
            "scientificName": "Carassius auratus",
            "fullName": "Carassius auratus (Goldfish)"
        },
        "name": "Sodium channel regulatory subunit beta-1",
        "description": [
            "Regulatory subunit of multiple voltage-gated sodium (Nav) channels directly mediating the depolarization of excitable membranes. Navs, also called VGSCs (voltage-gated sodium channels) or VDSCs (voltage-dependent sodium channels), operate by switching between closed and open conformations depending on the voltage difference across the membrane. In the open conformation they allow Na(+) ions to selectively pass through the pore, along their electrochemical gradient. The influx of Na+ ions provokes membrane depolarization, initiating the propagation of electrical signals throughout cells and tissues. The accessory beta subunits participate in localization and functional modulation of the Nav channels. Modulates the activity of SCN1A/Nav1.1, SCN2A/Nav1.2, SCN3A/Nav1.3, SCN4A/Nav1.4, SCN5A/Nav1.5, SCN8A/Nav1.6, SCN9A/Nav1.7 and SCN10A/Nav1.8"
        ],
        "length": 225,
        "sequence": "MMMMMMMMRRLLLLCVFCTLSVSLCSGACAEVDSDTEAVAGRSFKLGCISCKMRGEVKASATVDWMFRARGEADFVHIYSYDGEASSIIDERFQDRMEWHGSRNTYDLQDASVDLLNVTFNDSGVYRCVFNRVLSYEYYEFSTTATKLVQLSVVAKATRGTASIVSEVMMYVTIIGLQLWLLVEMIYCYRKISAAGEEALRASAAEYLAIASEGKDNCAGVQLAE",
        "proteome": "UP000515129",
        "gene": "scn1bb",
        "go_terms": [
            {
                "identifier": "GO:0017080",
                "name": "sodium channel regulator activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006814",
                "name": "sodium ion transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0001518",
                "name": "voltage-gated sodium channel complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5ed7c00baee6d5d5484012bbe9c8560ea78da669",
        "counters": {
            "domain_architectures": 138160,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 1,
                "ssf": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 138160
        }
    }
}