General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P6KR95",
        "id": "A0A6P6KR95_CARAU",
        "source_organism": {
            "taxId": "7957",
            "scientificName": "Carassius auratus",
            "fullName": "Carassius auratus (Goldfish)"
        },
        "name": "DNA excision repair protein ERCC-1",
        "description": [
            "Non-catalytic component of a structure-specific DNA repair endonuclease responsible for the 5'-incision during DNA repair. Responsible, in conjunction with SLX4, for the first step in the repair of interstrand cross-links (ICL). Participates in the processing of anaphase bridge-generating DNA structures, which consist in incompletely processed DNA lesions arising during S or G2 phase, and can result in cytokinesis failure. Also required for homology-directed repair (HDR) of DNA double-strand breaks, in conjunction with SLX4"
        ],
        "length": 341,
        "sequence": "MEKKRFNINLDDSALTKERIPVTSLFKAKDGQVETPSAPSAPPAPGQPLSYAEFVVQRKNRALQGAAHGPEKQSRNDAAGQSSVNTADSGSVSTSSTGSGKPETQEQGPAKVLTEDQTKEEGHSSESCIIPPHLLGSGNSIIVSPRQRGNPILKFVRNVPWEFGEVVPDYVLGRTTCAVFLSVRYHNLNPNYIHERLKQLGQSFTLRVLLVQVDVKDPHHALKELARICIMADCTLILAWSPEEAGRYLETYKSYEKKPADVLKEQVEKNYLSQVTDCLTTVKSVNKTDAMTLLSTFSSLEGIIKASKEELVLCPGLGPQKARRLYDVLHQPFIKSKKKES",
        "proteome": "UP000515129",
        "gene": "ercc1",
        "go_terms": [
            {
                "identifier": "GO:0003684",
                "name": "damaged DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005634",
                "name": "nucleus",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "99ad1a8c64a8f5b6023fb890d913233d29811bc6",
        "counters": {
            "domain_architectures": 2277,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2277
        }
    }
}