GET /api/protein/UniProt/A0A6P6JI88/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P6JI88",
"id": "A0A6P6JI88_CARAU",
"source_organism": {
"taxId": "7957",
"scientificName": "Carassius auratus",
"fullName": "Carassius auratus (Goldfish)"
},
"name": "UTP--glucose-1-phosphate uridylyltransferase",
"description": [
"UTP--glucose-1-phosphate uridylyltransferase catalyzing the conversion of glucose-1-phosphate into UDP-glucose, a crucial precursor for the production of glycogen"
],
"length": 492,
"sequence": "MAEFQEKLRLQHENSMHTELEKLLTTAKPSEAEISRKDFEGFKQLFHHFLQEKGPSVDWAKIQRPPEGSIQPYEKIKLKGLPADVASSLNKLAVVKLNGGLGTSMGCKGPKSLISVRNENTFLDLTVQQIEHLNKSYNADVPLVLMNSFNTDEDTKKILQKYSHHRVKIHTFNQSRYPRINKESLLPVATNMGLTGENEEAWYPPGHGDIYASFFNSGLLDKLIAEGKEYIFVSNIDNLGATVDLHILNHLMSQPSDKRCEFVMEVTDKTRADVKGGTLTQYDGKLRLLEIAQVPKAHVDEFKSVTKFKIFNTNNLWISLPAIKRLHEKNAMDMEIIVNPKTLDGGLNVIQLETAVGAAMKSFDNALGINVPRSRFLPVKTTSDLLLVMSNLYSMNAGSLTMSPKREFPTTPHVKLGSSFTKVQDFLKRIESIPDMLELDHLTVSGDVTFGKQVTLKGTVIIIANHGDRIDIPAGAMLENKIVSGNLRILDH",
"proteome": "UP000515129",
"gene": "LOC113044008",
"go_terms": [
{
"identifier": "GO:0003983",
"name": "UTP:glucose-1-phosphate uridylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006011",
"name": "UDP-alpha-D-glucose metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0070569",
"name": "uridylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "94e198e955f2cd10d0ca87ed10c772ebcbe0d255",
"counters": {
"domain_architectures": 17346,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17346
}
}
}