GET /api/protein/UniProt/A0A6P6IH16/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P6IH16",
"id": "A0A6P6IH16_PUMCO",
"source_organism": {
"taxId": "9696",
"scientificName": "Puma concolor",
"fullName": "Puma concolor (Mountain lion)"
},
"name": "Insulin-like growth factor-binding protein 6",
"description": [
"IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Activates the MAPK signaling pathway and induces cell migration"
],
"length": 132,
"sequence": "LVAVGENPKEGKSQAGTTRPQDVNRRDQQRNPGTSTTPARPSPGGAQDTEMGPCRRHLDSVLQQLQTEVYRGAQTLYVPNCDHRGFYRKRQCRSSQGQRRGPCWCVDRMGQPLPGSPEGEGGSSCPTGSSSG",
"proteome": "UP000515131",
"gene": "IGFBP6",
"go_terms": [
{
"identifier": "GO:0005520",
"name": "insulin-like growth factor binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "50039f4eef7e5001fec7852bb1ef6bc0689dfebe",
"counters": {
"domain_architectures": 3614,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"profile": 1,
"cdd": 1,
"pfam": 1,
"smart": 1,
"panther": 1,
"prints": 2,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3614
}
}
}