GET /api/protein/UniProt/A0A6P6HN24/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P6HN24",
        "id": "A0A6P6HN24_PUMCO",
        "source_organism": {
            "taxId": "9696",
            "scientificName": "Puma concolor",
            "fullName": "Puma concolor (Mountain lion)"
        },
        "name": "Cyclin-G1",
        "description": [
            "May play a role in growth regulation. Is associated with G2/M phase arrest in response to DNA damage. May be an intermediate by which p53 mediates its role as an inhibitor of cellular proliferation"
        ],
        "length": 379,
        "sequence": "MKFPGPLENQRLSFLLEKAISREAQMWKVNVPKMPTNQNVSPSQRDEVIQWLAKLKYQFNLYPETFALASSLLDRFLATVKAHPKYLSCIAISCFFLAAKTVEEDERIPVLKVLARDSFCGCSSSEILRMERIILDKLNWDLHTATPLDFLHIFHAIAVSARPQLLFSLPKLSPSQHLAVLTKQLLHCMACNQLLQFKGSMLALAMVSLEMEKLIPDWLPLTIELLQKAQMASSQLIHCRELVAHHLSSLQSSLPLNSVYVYRPLKHTLVTCDKGVFRLHPSSVPGPDLDFSKDNSKPEVPVRGAAAFYHHLPAASGCKHTSAKRKVEEMEVDDFYDGIKRLYNEDNASESVGSVCGTDLSRQEGHASPCPPLQPVSVM",
        "proteome": "UP000515131",
        "gene": "CCNI",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "246d6f3d1006b98b5d45ce8e20e10ece6e9ef8a9",
        "counters": {
            "domain_architectures": 34424,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "pfam": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 34424
        }
    }
}