GET /api/protein/UniProt/A0A6P6E9M7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P6E9M7",
        "id": "A0A6P6E9M7_OCTDE",
        "source_organism": {
            "taxId": "10160",
            "scientificName": "Octodon degus",
            "fullName": "Octodon degus (Degu)"
        },
        "name": "S-phase kinase-associated protein 1",
        "description": [
            "Essential component of the SCF (SKP1-CUL1-F-box protein) ubiquitin ligase complex, which mediates the ubiquitination of proteins involved in cell cycle progression, signal transduction and transcription. In the SCF complex, serves as an adapter that links the F-box protein to CUL1",
            "The functional specificity of the SCF complex depends on the F-box protein as substrate recognition component"
        ],
        "length": 163,
        "sequence": "MPSIKLQSSDGEIFEVDVEIAKQSVTIKTMLEDLGMDDEGDDDPVPLPNVNAAILKKVIQWCTHHKDDPPPPEDDENKEKRTDDIPVWDQEFLKVDQGTLFELILAANYLDIKGLLDVTCKTVANMIKGKSPEEIRKTFNIKNDFTEEEEAQVRKENQWCEEK",
        "proteome": "UP000515203",
        "gene": "Skp1",
        "go_terms": [
            {
                "identifier": "GO:0006511",
                "name": "ubiquitin-dependent protein catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "3199382cafd42d17192238da0f86c9cfb0634da5",
        "counters": {
            "domain_architectures": 10809,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "pfam": 2,
                "ssf": 2,
                "cdd": 1,
                "pirsf": 1,
                "panther": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10809
        }
    }
}