GET /api/protein/UniProt/A0A6P6CW49/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P6CW49",
"id": "A0A6P6CW49_PTEVA",
"source_organism": {
"taxId": "132908",
"scientificName": "Pteropus vampyrus",
"fullName": "Pteropus vampyrus (Large flying fox)"
},
"name": "Delta(14)-sterol reductase TM7SF2",
"description": [
"Catalyzes the reduction of the C14-unsaturated bond of lanosterol, as part of the metabolic pathway leading to cholesterol biosynthesis"
],
"length": 317,
"sequence": "MLLPLAFVATLTAFIFSLLLYLKALLAPTSTLAPGGNSGNPIYDFFLGRELNPRIRSFDFKYFCELRPGLIGWVLINLALLMKEAELRGSPSLAMWLVNGFQLLYVGDALWQEEAVLTTMDITHDGFGFMLAFGDLAWVPFTYSLQAQFLLYHPQPLGLPMASVICLINAFGFYIFRGANSQKNTFRKNPSDPRVADLETIPTATGRQLLVSGWWGMVRHPNYLGDLIMALAWSLPCGEWLGWGHIRVRGRDGVVTAGYPVWVWNGERGCTPVEGVVREPGPDSGCGWGRCRRQPSAASTLSWSLASLRLSADAVSH",
"proteome": "UP000515202",
"gene": "TM7SF2",
"go_terms": [
{
"identifier": "GO:0016628",
"name": "oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016126",
"name": "sterol biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9a69035bc8c6d4031bf06ea0caf3992496028c64",
"counters": {
"domain_architectures": 10044,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 10044
}
}
}