General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P6CVK7",
        "id": "A0A6P6CVK7_PTEVA",
        "source_organism": {
            "taxId": "132908",
            "scientificName": "Pteropus vampyrus",
            "fullName": "Pteropus vampyrus (Large flying fox)"
        },
        "name": "FERM domain-containing protein 8",
        "description": [
            "Promotes the cell surface stability of iRhom1/RHBDF1 and iRhom2/RHBDF2 and prevents their degradation via the endolysosomal pathway. By acting on iRhoms, involved in ADAM17-mediated shedding of TNF, amphiregulin/AREG, HBEGF and TGFA from the cell surface. Negatively regulates Wnt signaling, possibly by antagonizing the recruitment of AXIN1 to LRP6"
        ],
        "length": 465,
        "sequence": "MDGTESSAGQPGPSERSHRSSVSSMGARAADVLVYLADDSVVPLAVENLPSFSAHELHRAIREVLQLPDIALDAFALWLVSPLLEVQLKPKHQPYKLGRQWPELLLRFTDAPDDDVATDEPSLQFRRNVFFPKRRELQIRDEEVLRLLYEEAKGNVLAARYPCDVEDCEALGALVCRVQLGPYRPGQPTACTLREKLGSFLPAHLCKRGHGLFAALRGRGTKAGTGEQGLLDAYRKVKEVVGSDSECEAPLGTHYHAYLLKCHELPFYGSAFFHGEVDKPAQGFLPRGGRKPVTVAISLEGVHVMDSREKHVLLGLRFQELSWDHTSPEEEESVLWLEFDGNNEGTPVNKLLKIYSKQAELMSSLIEYCIELNQAMEPAAPAESASGSPSIPSSPPPPTQRPQLRRQGSVVCSRIQHLSTIDYVEEGEQIKRVKPKRTTSFFSRQLSMGQGSYTVVQPAESPEQS",
        "proteome": "UP000515202",
        "gene": "FRMD8",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "fcf976a4894c185bae91011ff3d1573bba7dd818",
        "counters": {
            "domain_architectures": 1187,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 3,
                "smart": 1,
                "profile": 1,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1187
        }
    }
}