General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P6CUE3",
        "id": "A0A6P6CUE3_PTEVA",
        "source_organism": {
            "taxId": "132908",
            "scientificName": "Pteropus vampyrus",
            "fullName": "Pteropus vampyrus (Large flying fox)"
        },
        "name": "Ig-like domain-containing protein",
        "description": [
            "Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation"
        ],
        "length": 254,
        "sequence": "MASLGQIIFWSIISSIIVLAGAIALIIGFGISGTHSITVTTLTSAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVTGLVHEFKEGKDDLSDQNEMFRGRTAVFADQVRVGNASLRLKNVRLTDAGTYKCYVLTANGKGNAGLEYKTGAFSIPEMDVDYNASSESFRCEAPRWFPQPTVVWTSQADLRANFSQVSNTSFELNSENVTMKVVSILYNVTINNTYSCMIENDLAKATGDIKVTGGFLHSFCMGLLG",
        "proteome": "UP000515202",
        "gene": "VTCN1",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "5ed7c00baee6d5d5484012bbe9c8560ea78da669",
        "counters": {
            "domain_architectures": 138160,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 138160
        }
    }
}