General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P5QQ94",
        "id": "A0A6P5QQ94_MUSCR",
        "source_organism": {
            "taxId": "10089",
            "scientificName": "Mus caroli",
            "fullName": "Mus caroli (Ryukyu mouse)"
        },
        "name": "Small ubiquitin-related modifier",
        "description": [
            "Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. Plays a role in the regulation of sumoylation status of SETX"
        ],
        "length": 110,
        "sequence": "MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGSASRGSVPTPNRCPDLCY",
        "proteome": "UP000515126",
        "gene": "Sumo3",
        "go_terms": [
            {
                "identifier": "GO:0005515",
                "name": "protein binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d303435dad0fc9a37f7e012a6fcc15c91546d59d",
        "counters": {
            "domain_architectures": 14220,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "profile": 1,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14220
        }
    }
}