GET /api/protein/UniProt/A0A6P5QBB0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P5QBB0",
"id": "A0A6P5QBB0_MUSCR",
"source_organism": {
"taxId": "10089",
"scientificName": "Mus caroli",
"fullName": "Mus caroli (Ryukyu mouse)"
},
"name": "ATP-sensitive inward rectifier potassium channel 14",
"description": [
"Inward rectifier potassium channels are characterized by a greater tendency to allow potassium to flow into the cell rather than out of it. Their voltage dependence is regulated by the concentration of extracellular potassium; as external potassium is raised, the voltage range of the channel opening shifts to more positive voltages"
],
"length": 434,
"sequence": "MGLARALRRLSGALEPGNSRAGDEEEAGAGLCRNGWAPGPVAGSRRRGRFVKKDGHCNVRFVNLGGQGARYLSDLFTTCVDVRWRWMCLLFSCSFLASWLLFGLTFWLIASLHGDLAAPPPPAPCFSQVASFLAAFLFALETQTSIGYGVRSVTEECPAAVAAVVLQCIAGCVLDAFVVGAVMAKMAKPKKRNETLVFSENAVVALRDHRLCLMWRVGNLRRSHLVEAHVRAQLLQPRVTPEGEYIPLDHQDVDVGFDGGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELVVILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPVCSAKELDERAEQASHSPKSSFPGSLTAFCYENELALSCCQEEDEEEDTKEGTSAETPERAASPQALTPTLALTLPP",
"proteome": "UP000515126",
"gene": "Kcnj14",
"go_terms": [
{
"identifier": "GO:0005242",
"name": "inward rectifier potassium channel activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006813",
"name": "potassium ion transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e7a59055e1b20178b6e101f48a7067c5d642e21e",
"counters": {
"domain_architectures": 15818,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"pfam": 2,
"ssf": 2,
"panther": 1,
"pirsf": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 15818
}
}
}