General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P5Q632",
        "id": "A0A6P5Q632_MUSCR",
        "source_organism": {
            "taxId": "10089",
            "scientificName": "Mus caroli",
            "fullName": "Mus caroli (Ryukyu mouse)"
        },
        "name": "Vacuolar protein sorting-associated protein 37A",
        "description": [
            "Component of the ESCRT-I complex, a regulator of vesicular trafficking process. Required for the sorting of endocytic ubiquitinated cargos into multivesicular bodies. May be involved in cell growth and differentiation"
        ],
        "length": 397,
        "sequence": "MSWLFPLAKSASSSAAGSPAGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNNLTININILLPPQFPQEKPVISVYPPIRHHLMDSQGLYVTSPLVSNFTMHSDLGKIIQSLLDEFWKNPPVLAPTSTTFPYLYSNPGGMPPYPSQGFSFLPPYPPQEANRSITSLSVADTVSSSTTSYTAAKPVAPSFGILSSLPLPVPTTESSASVNQNGFGYKMPDIPDAFPELSELSVSQLTDMNEQEEVLLEQFLMLPQLKQIITDKEDLVKNIEELARRNLLLEHSLEGKRQTVLDKYELLLQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEIDDFLNSFKEKRTICHCRRAKEEKLHQVIAMHSQFHAPL",
        "proteome": "UP000515126",
        "gene": "Vps37a",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "109788746530f21004788ac02c3085a3efa61ca7",
        "counters": {
            "domain_architectures": 7740,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "cdd": 1,
                "ssf": 2,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7740
        }
    }
}