GET /api/protein/UniProt/A0A6P5P063/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P5P063",
        "id": "A0A6P5P063_MUSCR",
        "source_organism": {
            "taxId": "10089",
            "scientificName": "Mus caroli",
            "fullName": "Mus caroli (Ryukyu mouse)"
        },
        "name": "Deoxyribonuclease",
        "description": [
            "Divalent cation-dependent acid DNA endonuclease involved in the breakdown of the nucleus during corneocyte formation of epidermal keratinocytes. May play an immune role by eliminating harmful DNA released into the extracellular environment by damaged epidermal cells"
        ],
        "length": 305,
        "sequence": "MGWPWAPLTAVWALGIMGATALRIGAFNVQSFGDNKVSDPDCGSVIAQILAGYDIALVQEVRDPDLSAVSLLMEQINRVSKHEYGFVSSKPLGRDQYKEMYLFVYRKDVASVVSTYQYPDPEDAFSREPFVVKFSVPSCGELILPSPRQTYLFQASLDPHIPSPSTAAKELVLIPLHAAPHQAVAEIDALYDVYLDVIDKWNTDDMLFLGDFNADCKYVKEHDWPSIRLRSSEVFKWLIPDSVDTTVGNSDCAYDRIVVSGAHLRRSLKPHSASVHNFQEEFDLDQTQALAISDHFPVEVTFKPH",
        "proteome": "UP000515126",
        "gene": "Dnase1l2",
        "go_terms": [
            {
                "identifier": "GO:0004536",
                "name": "DNA nuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006308",
                "name": "DNA catabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "01d417aef5428373d5752df5b6a37440f3868628",
        "counters": {
            "domain_architectures": 156843,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "ssf": 1,
                "cdd": 1,
                "pfam": 1,
                "pirsf": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 156843
        }
    }
}