GET /api/protein/UniProt/A0A6P5M4E2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P5M4E2",
        "id": "A0A6P5M4E2_PHACI",
        "source_organism": {
            "taxId": "38626",
            "scientificName": "Phascolarctos cinereus",
            "fullName": "Phascolarctos cinereus (Koala)"
        },
        "name": "Pirin",
        "description": [
            "Transcriptional coregulator of NF-kappa-B which facilitates binding of NF-kappa-B proteins to target kappa-B genes in a redox-state-dependent manner. May be required for efficient terminal myeloid maturation of hematopoietic cells. Has quercetin 2,3-dioxygenase activity (in vitro)"
        ],
        "length": 263,
        "sequence": "MPCLDFATLIHRRKKKKGPEVRIYSSDFTMGNPKKVMLTVLSQEQAEGVGARVRRSIGRPELKNLDPFLLFDEFKVAKPAGFPDHPHRGFETVSYLLEGGSTAHEDFCGHSGKMDPGDLQWMTAGRGILHAEMPCSEETAHGLQLWVNLRSSEKMVEPHYQGLKSKEIPKPSKNGVTISVISGEALGVESKIFTRTPTLYLEFKLDQGAKHCQPVPEGWTAFIYTLSGNVCIGPDGEQQKVEPHHSAVLGGGDSVQVENKVHL",
        "proteome": "UP000515140",
        "gene": "PIR",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1f52b3cd28c972b19d878d2615595eecddb7c22f",
        "counters": {
            "domain_architectures": 28960,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "pirsf": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 28960
        }
    }
}