HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P5M0A7",
"id": "A0A6P5M0A7_PHACI",
"source_organism": {
"taxId": "38626",
"scientificName": "Phascolarctos cinereus",
"fullName": "Phascolarctos cinereus (Koala)"
},
"name": "AP complex subunit sigma",
"description": [
"Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the late-Golgi/trans-Golgi network (TGN) and/or endosomes. The AP complexes mediate both the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules"
],
"length": 160,
"sequence": "MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEDAKEAETPRSVLEEIGLT",
"proteome": "UP000515140",
"gene": "AP1S2",
"go_terms": [
{
"identifier": "GO:0035615",
"name": "clathrin-cargo adaptor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016192",
"name": "vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030121",
"name": "AP-1 adaptor complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015031",
"name": "protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006886",
"name": "intracellular protein transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030117",
"name": "membrane coat",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "06d32c800fac36020d03f379936b1bd62ff88561",
"counters": {
"domain_architectures": 27458,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pirsf": 1,
"panther": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 27458
}
}
}