GET /api/protein/UniProt/A0A6P5LT39/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P5LT39",
"id": "A0A6P5LT39_PHACI",
"source_organism": {
"taxId": "38626",
"scientificName": "Phascolarctos cinereus",
"fullName": "Phascolarctos cinereus (Koala)"
},
"name": "mRNA decay activator protein ZFP36",
"description": [
"Zinc-finger RNA-binding protein that destabilizes several cytoplasmic AU-rich element (ARE)-containing mRNA transcripts by promoting their poly(A) tail removal or deadenylation, and hence provide a mechanism for attenuating protein synthesis. Acts as a 3'-untranslated region (UTR) ARE mRNA-binding adapter protein to communicate signaling events to the mRNA decay machinery. Functions by recruiting the CCR4-NOT deadenylase complex and probably other components of the cytoplasmic RNA decay machinery to the bound ARE-containing mRNAs, and hence promotes ARE-mediated mRNA deadenylation and decay processes. Binds to 3'-UTR ARE of numerous mRNAs"
],
"length": 374,
"sequence": "MRGKVSCMKENIGSHRLDHVLPASTTDYIAEAWQLSASLCRNSRLPLRSMTPFMQNNKMLNYGPSSPGGCLLDRKAVGTPAGGGFPRRHSVTLPSSKFHQNQLLSSLKAGEPSQALSSRDSRFRDRSFSEGGERLLPPQKQPGGGQVNSSRYKTELCRPFEENGACKYGDKCQFAHGIHELRSLTRHPKYKTELCRTFHTIGFCPYGPRCHFIHNAEERRALAGGRDPSADRPRLHHSFSFSGFPSAATAATTGLLDSPTSITPPPILSADDLLGSPTLPDGANNPFAYSSQELASLFAPSMGVPGGGSPTTFLFRPMSESPHMFDSPPSPQDSLSDQEGYLSSSSSSHSGSDSPTLDNSRRLPIFSRLSISDD",
"proteome": "UP000515140",
"gene": "ZFP36L1",
"go_terms": [
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003729",
"name": "mRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "b03790f892894dbb02da155cb49964a170480e54",
"counters": {
"domain_architectures": 1310,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"profile": 1,
"pfam": 2,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1310
}
}
}