GET /api/protein/UniProt/A0A6P5KWB8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P5KWB8",
        "id": "A0A6P5KWB8_PHACI",
        "source_organism": {
            "taxId": "38626",
            "scientificName": "Phascolarctos cinereus",
            "fullName": "Phascolarctos cinereus (Koala)"
        },
        "name": "1-acylglycerol-3-phosphate O-acyltransferase ABHD5",
        "description": [
            "Coenzyme A-dependent lysophosphatidic acid acyltransferase that catalyzes the transfer of an acyl group on a lysophosphatidic acid. Functions preferentially with 1-oleoyl-lysophosphatidic acid followed by 1-palmitoyl-lysophosphatidic acid, 1-stearoyl-lysophosphatidic acid and 1-arachidonoyl-lysophosphatidic acid as lipid acceptor. Functions preferentially with arachidonoyl-CoA followed by oleoyl-CoA as acyl group donors. Functions in phosphatidic acid biosynthesis. May regulate the cellular storage of triacylglycerol through activation of the phospholipase PNPLA2. Involved in keratinocyte differentiation. Regulates lipid droplet fusion"
        ],
        "length": 365,
        "sequence": "MLRGAFLPGWGEPGLSVGARSDPGRGRLSAYLRDCIVTGWDASLLQEPPQKPAGGLSEHPDLRSRLGHPRACGGGGSLGVVERVDLPSRSGWLTGWLPTWCPTSLSLLKEAEEKILKCVPCPYKKESVCISSGNKIWTLKFSQDIAHKTPLVLLHGFGGGVGLWALNFGDLCENRPVYALDLLGFGRSSRPPFGSDAVEAEDQFVDTIEEWRCALSLDAVILLGHNLGGFLAAAYSLKYPSRVKHLILVEPWGFPERPDNADQDRPIPVWIKALGAVLTPFNPLAGLRIAGPFGLSLVQRLRPDFKRKYASMFEDDTVTEYIYHCNVQTPSGETAFRNMTIPYGWAKRPMLLRIGYPWCGTLCVC",
        "proteome": "UP000515140",
        "gene": "ABHD5",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4208e7859dea7ff67287230d6f84ba11d78c698d",
        "counters": {
            "domain_architectures": 386493,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 386493
        }
    }
}