HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P5IY93",
"id": "A0A6P5IY93_PHACI",
"source_organism": {
"taxId": "38626",
"scientificName": "Phascolarctos cinereus",
"fullName": "Phascolarctos cinereus (Koala)"
},
"name": "Retina and anterior neural fold homeobox protein 2",
"description": [
"May be involved in modulating the expression of photoreceptor specific genes. Binds to the Ret-1 and Bat-1 element within the rhodopsin promoter"
],
"length": 229,
"sequence": "MSQMGIITPPVTIHTTGGAMFLSKCEGEPAEGRPPGSLEAEEAPKKKHRRNRTTFTTFQLHQLERAFERSHYPDVYSREELATQVNLPEVRVQVWFQNRRAKWRRQEKLEASSTAAVAAAAAATKLPEAPMLAFSRPPPAASLPLDPWLTSGPPAMHAFPGFLGPRPGLQPTYGPHAFLHTSSGPPPFGEAFGPLAEAGDAHARSSSIVSLCFRAKEHVQTLDRTWQPL",
"proteome": "UP000515140",
"gene": "RAX2",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000981",
"name": "DNA-binding transcription factor activity, RNA polymerase II-specific",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045944",
"name": "positive regulation of transcription by RNA polymerase II",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "1cca9db9652b5e6e0313f2eed7be72cec278d12f",
"counters": {
"domain_architectures": 145457,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"profile": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 145457
}
}
}