GET /api/protein/UniProt/A0A6P5DDQ0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P5DDQ0",
"id": "A0A6P5DDQ0_BOSIN",
"source_organism": {
"taxId": "9915",
"scientificName": "Bos indicus",
"fullName": "Bos indicus (Zebu)"
},
"name": "B9 domain-containing protein 2",
"description": [
"Component of the tectonic-like complex, a complex localized at the transition zone of primary cilia and acting as a barrier that prevents diffusion of transmembrane proteins between the cilia and plasma membranes"
],
"length": 175,
"sequence": "MAEVHVIGQIMGATGFSESSLFCKWGVHTGAAWKLLSGVREGQTQVDTPQIGDMAYWSHPIDLHFATKGLQGWPRLHLQVWSQDSFGRCQLAGYGFCHVPSSPGTHQLDCPTWRPLGSWREQLARAFVGGGPQLLHGDAIYSGADRYRLHTTSGGTVHLELSLLLRHFDRYGVEC",
"proteome": "UP001652663",
"gene": "B9D2",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4f5bc55abc4fa213138b9c0a009d722284d0dc89",
"counters": {
"domain_architectures": 5503,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5503
}
}
}