GET /api/protein/UniProt/A0A6P5CBG1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P5CBG1",
"id": "A0A6P5CBG1_BOSIN",
"source_organism": {
"taxId": "9915",
"scientificName": "Bos indicus",
"fullName": "Bos indicus (Zebu)"
},
"name": "Autophagy protein 5",
"description": [
"Involved in autophagic vesicle formation",
"May play an important role in the apoptotic process, possibly within the modified cytoskeleton. Its expression is a relatively late event in the apoptotic process, occurring downstream of caspase activity. Plays a crucial role in IFN-gamma-induced autophagic cell death by interacting with FADD"
],
"length": 272,
"sequence": "MHYPIGLLFDLLASSSALPWNITVHFKSFPEKDLLHCPSKDVIEAHFMSCVKEADALKHKSQVINEMQKKDHKQLWMGLQNDRFDQFWAINRKLMEYPAEENGFRYIPFRIYQTTTERPFIQKLFRPVSTDGQLHTLGDLLKEVCPSAVAPEVPMPEVCSWLPTWLLASSAEGSHLPSLWRDWEEDGPRLSQQGAENRRNQSPGTETLPNTVLPVEAKIKPTFEPSRIAGGRKASLAVKCWASQGPSRVFIARKKFHWFRTKLKQQVFRAGV",
"proteome": "UP001652663",
"gene": "ATG5",
"go_terms": [
{
"identifier": "GO:0006914",
"name": "autophagy",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ee45ca3a0a493d768009ea02f61d26e83a4b9f11",
"counters": {
"domain_architectures": 3776,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 3,
"cathgene3d": 2,
"panther": 1,
"interpro": 6
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3776
}
}
}