GET /api/protein/UniProt/A0A6P5C256/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P5C256",
"id": "A0A6P5C256_BOSIN",
"source_organism": {
"taxId": "9915",
"scientificName": "Bos indicus",
"fullName": "Bos indicus (Zebu)"
},
"name": "Phosphatidylinositol N-acetylglucosaminyltransferase subunit P",
"description": [
"Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis"
],
"length": 128,
"sequence": "MVENSPSPLPERAIYGFVLFLSSQFGFILYLVWAFVPESWLNSLGLTYWPQKYWAVALPVYLLITIVIGYVLLFGINMMSTSPLDSIHNITDNYAKNQQHKKDQEEAIPALRDIPISEVNQMFFLEAK",
"proteome": "UP001652663",
"gene": "PIGP",
"go_terms": [
{
"identifier": "GO:0017176",
"name": "phosphatidylinositol N-acetylglucosaminyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006506",
"name": "GPI anchor biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "63d625aebca36dff5d9df899680f5b452f6f2c81",
"counters": {
"domain_architectures": 3920,
"entries": 6,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pirsf": 1,
"panther": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3920
}
}
}