GET /api/protein/UniProt/A0A6P3Y2W6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3Y2W6",
        "id": "A0A6P3Y2W6_DINQU",
        "source_organism": {
            "taxId": "609295",
            "scientificName": "Dinoponera quadriceps",
            "fullName": "Dinoponera quadriceps (South American ant)"
        },
        "name": "Fructose-1,6-bisphosphatase isozyme 2",
        "description": [
            "Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations and probably participates in glycogen synthesis from carbohydrate precursors, such as lactate"
        ],
        "length": 333,
        "sequence": "MATKNTMLDSDCMTLTRFVLAEQRKVPTATGDLSQLLNSIQTAVKAVSSAVRKAGIANMYGIAGNTNVQGEEVKKLDVLSNELFINMLTSSFTTCVLVSEENQHAIEVETEKRGKYIVCFDPLDGSSNIDCLVSVGSIFGIYKKVEQSDAALQPGRNLVAAGYALYGSATMIVLSIGHGVNGFTYDPAIGEFILTEKNMRLPARGDIYSINEGHESAWDSSIKEYIRTKKYPVSGKPYSARYVGSMVADVHRTIKYGGIFLYPATKSNPNGKLRLLYECIPMAFIIKEAGGLATNGKIDILDIVPESIHQRSPIFLGSKDDVDDVMDCIKNSQ",
        "proteome": "UP000515204",
        "gene": "LOC106749529",
        "go_terms": [
            {
                "identifier": "GO:0016791",
                "name": "phosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042132",
                "name": "fructose 1,6-bisphosphate 1-phosphatase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0042578",
                "name": "phosphoric ester hydrolase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "54ec59f5adc6685885f88a6300d502f5ee1d8cbf",
        "counters": {
            "domain_architectures": 19714,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "ncbifam": 1,
                "pirsf": 2,
                "hamap": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 19714
        }
    }
}