HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3Y2W6",
"id": "A0A6P3Y2W6_DINQU",
"source_organism": {
"taxId": "609295",
"scientificName": "Dinoponera quadriceps",
"fullName": "Dinoponera quadriceps (South American ant)"
},
"name": "Fructose-1,6-bisphosphatase isozyme 2",
"description": [
"Catalyzes the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate in the presence of divalent cations and probably participates in glycogen synthesis from carbohydrate precursors, such as lactate"
],
"length": 333,
"sequence": "MATKNTMLDSDCMTLTRFVLAEQRKVPTATGDLSQLLNSIQTAVKAVSSAVRKAGIANMYGIAGNTNVQGEEVKKLDVLSNELFINMLTSSFTTCVLVSEENQHAIEVETEKRGKYIVCFDPLDGSSNIDCLVSVGSIFGIYKKVEQSDAALQPGRNLVAAGYALYGSATMIVLSIGHGVNGFTYDPAIGEFILTEKNMRLPARGDIYSINEGHESAWDSSIKEYIRTKKYPVSGKPYSARYVGSMVADVHRTIKYGGIFLYPATKSNPNGKLRLLYECIPMAFIIKEAGGLATNGKIDILDIVPESIHQRSPIFLGSKDDVDDVMDCIKNSQ",
"proteome": "UP000515204",
"gene": "LOC106749529",
"go_terms": [
{
"identifier": "GO:0016791",
"name": "phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042132",
"name": "fructose 1,6-bisphosphate 1-phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0042578",
"name": "phosphoric ester hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "54ec59f5adc6685885f88a6300d502f5ee1d8cbf",
"counters": {
"domain_architectures": 19714,
"entries": 18,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 2,
"cdd": 1,
"panther": 1,
"ncbifam": 1,
"pirsf": 2,
"hamap": 1,
"prints": 1,
"prosite": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 19714
}
}
}