GET /api/protein/UniProt/A0A6P3WMM9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3WMM9",
        "id": "A0A6P3WMM9_DINQU",
        "source_organism": {
            "taxId": "609295",
            "scientificName": "Dinoponera quadriceps",
            "fullName": "Dinoponera quadriceps (South American ant)"
        },
        "name": "Phospholipid scramblase",
        "description": [
            "May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane"
        ],
        "length": 267,
        "sequence": "MSNPYAAIYPPSGKGHPDAQQPIATAPPPGMFPVSQPHPNAAVTPQGGWSPPNTIYPSGLEYLMGLDYLFVNQKVELLEVFTGFETKNRYAIMDVTGKPVFYAAEESDVCSRLCLGSARPCDFSVVDLNGREVLRMSRPFRCDSCCCPCCLQIMEIYSGNLLLGTVTQEWSLWRPTFTVRDATGNPVLIIKGPIIRFCIEVVFKVKSLDEKQNVGVIQKNWGGFSRELFTDADRFGVQFPRDLDVKIKAVLLGACLLLDFMYFENRS",
        "proteome": "UP000515204",
        "gene": "LOC106740632",
        "go_terms": [
            {
                "identifier": "GO:0017128",
                "name": "phospholipid scramblase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0017121",
                "name": "plasma membrane phospholipid scrambling",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7774078d97db0587fbf31eeb9b45e29a15d8d6a5",
        "counters": {
            "domain_architectures": 8803,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "ssf": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 8803
        }
    }
}