GET /api/protein/UniProt/A0A6P3WMM9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3WMM9",
"id": "A0A6P3WMM9_DINQU",
"source_organism": {
"taxId": "609295",
"scientificName": "Dinoponera quadriceps",
"fullName": "Dinoponera quadriceps (South American ant)"
},
"name": "Phospholipid scramblase",
"description": [
"May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane"
],
"length": 267,
"sequence": "MSNPYAAIYPPSGKGHPDAQQPIATAPPPGMFPVSQPHPNAAVTPQGGWSPPNTIYPSGLEYLMGLDYLFVNQKVELLEVFTGFETKNRYAIMDVTGKPVFYAAEESDVCSRLCLGSARPCDFSVVDLNGREVLRMSRPFRCDSCCCPCCLQIMEIYSGNLLLGTVTQEWSLWRPTFTVRDATGNPVLIIKGPIIRFCIEVVFKVKSLDEKQNVGVIQKNWGGFSRELFTDADRFGVQFPRDLDVKIKAVLLGACLLLDFMYFENRS",
"proteome": "UP000515204",
"gene": "LOC106740632",
"go_terms": [
{
"identifier": "GO:0017128",
"name": "phospholipid scramblase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0017121",
"name": "plasma membrane phospholipid scrambling",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7774078d97db0587fbf31eeb9b45e29a15d8d6a5",
"counters": {
"domain_architectures": 8803,
"entries": 5,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 8803
}
}
}