GET /api/protein/UniProt/A0A6P3VPJ6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3VPJ6",
"id": "A0A6P3VPJ6_CLUHA",
"source_organism": {
"taxId": "7950",
"scientificName": "Clupea harengus",
"fullName": "Clupea harengus (Atlantic herring)"
},
"name": "Golgi transport 1Bb",
"description": [
"May be involved in fusion of ER-derived transport vesicles with the Golgi complex"
],
"length": 138,
"sequence": "MISLTDSQKIGMGLTGFGVFFLFFGMILFFDKALLAIGNILFVTGLSFVIGLERTFRFFFQRHKAKATSFFLGGVFIVLIGWPIVGVVLETYGFFLLFRGFFPVAVGFIRRIPILGSLLNLPGISGLVDKVGESNTMV",
"proteome": "UP000515152",
"gene": "golt1bb",
"go_terms": [
{
"identifier": "GO:0006888",
"name": "endoplasmic reticulum to Golgi vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0042147",
"name": "retrograde transport, endosome to Golgi",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016192",
"name": "vesicle-mediated transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "cd7cfd636139ec50f795e8146efb12755b39273f",
"counters": {
"domain_architectures": 14819,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 14819
}
}
}