GET /api/protein/UniProt/A0A6P3TF60/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3TF60",
"id": "A0A6P3TF60_SHEEP",
"source_organism": {
"taxId": "9940",
"scientificName": "Ovis aries",
"fullName": "Ovis aries (Sheep)"
},
"name": "Fibroblast growth factor",
"description": [
"Plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. Required for normal branching morphogenesis. Growth factor active on keratinocytes. Possible major paracrine effector of normal epithelial cell proliferation"
],
"length": 194,
"sequence": "MRKWILTWILPSLLYRSCFHIICLVGTISLACNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGVPVRGKKTKKEQKTAHFLPMAIT",
"proteome": null,
"gene": "JEQ12_018271",
"go_terms": [
{
"identifier": "GO:0008083",
"name": "growth factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5171d0377b6deb31d3e4658b327f83b114bedf70",
"counters": {
"domain_architectures": 24103,
"entries": 12,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"panther": 1,
"prints": 2,
"prosite": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 24103
}
}
}