General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3R7M4",
        "id": "A0A6P3R7M4_PTEVA",
        "source_organism": {
            "taxId": "132908",
            "scientificName": "Pteropus vampyrus",
            "fullName": "Pteropus vampyrus (Large flying fox)"
        },
        "name": "Selenoprotein K",
        "description": [
            "Required for Ca(2+) flux in immune cells and plays a role in T-cell proliferation and in T-cell and neutrophil migration. Involved in endoplasmic reticulum-associated degradation (ERAD) of soluble glycosylated proteins. Required for palmitoylation and cell surface expression of CD36 and involved in macrophage uptake of low-density lipoprotein and in foam cell formation. Together with ZDHHC6, required for palmitoylation of ITPR1 in immune cells, leading to regulate ITPR1 stability and function. Plays a role in protection of cells from ER stress-induced apoptosis. Protects cells from oxidative stress when overexpressed in cardiomyocytes"
        ],
        "length": 91,
        "sequence": "MVYISNGQVLDSRSQSPWRLSLITDFFWGIAEFVVLFFKTLLQQDVKKRRGYRNSSDSRYDDGRGPPGNPPRRMGRINHLQGPNPPPMAGG",
        "proteome": "UP000515202",
        "gene": "SELENOK",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1dad5c0fb523196560339e2ab7d4e552f6090c8a",
        "counters": {
            "domain_architectures": 2157,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2157
        }
    }
}