GET /api/protein/UniProt/A0A6P3R2A1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3R2A1",
"id": "A0A6P3R2A1_PTEVA",
"source_organism": {
"taxId": "132908",
"scientificName": "Pteropus vampyrus",
"fullName": "Pteropus vampyrus (Large flying fox)"
},
"name": "Beta-1,4-galactosyltransferase",
"description": [
"Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids"
],
"length": 344,
"sequence": "MGFHMTFYLSYKFRLLLLFTLCLTVVGWATSNYFVGAIQEIPKAKDFIANFNKAIVLGKKETLTNEASVKKADLDNCPSTSPYLRGQDKLIFKPDLTLEEVQAENPRVHRGRYHPEECKALQRVAILIPHRNREKHLMYLLEHLHPFLQRQQLEYGIYIIHQAGSKKFNRAKLLNVGYLEALKDENWDCFIFHDVDLVPENDLNLYRCEDQPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELHRMKIIRPMPEVGKYTMIFHTRDLGNEVNIERMKLLHQVSRVWRTDGLNSCIYKLVSVDYNPLYINITVDFWSAP",
"proteome": "UP000515202",
"gene": "B4GALT4",
"go_terms": [
{
"identifier": "GO:0016757",
"name": "glycosyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6a47bda1daaa1ee01d682b5ff075f7c38c72fa06",
"counters": {
"domain_architectures": 11614,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"cdd": 1,
"panther": 1,
"prints": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 11614
}
}
}