GET /api/protein/UniProt/A0A6P3R2A1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3R2A1",
        "id": "A0A6P3R2A1_PTEVA",
        "source_organism": {
            "taxId": "132908",
            "scientificName": "Pteropus vampyrus",
            "fullName": "Pteropus vampyrus (Large flying fox)"
        },
        "name": "Beta-1,4-galactosyltransferase",
        "description": [
            "Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids"
        ],
        "length": 344,
        "sequence": "MGFHMTFYLSYKFRLLLLFTLCLTVVGWATSNYFVGAIQEIPKAKDFIANFNKAIVLGKKETLTNEASVKKADLDNCPSTSPYLRGQDKLIFKPDLTLEEVQAENPRVHRGRYHPEECKALQRVAILIPHRNREKHLMYLLEHLHPFLQRQQLEYGIYIIHQAGSKKFNRAKLLNVGYLEALKDENWDCFIFHDVDLVPENDLNLYRCEDQPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELHRMKIIRPMPEVGKYTMIFHTRDLGNEVNIERMKLLHQVSRVWRTDGLNSCIYKLVSVDYNPLYINITVDFWSAP",
        "proteome": "UP000515202",
        "gene": "B4GALT4",
        "go_terms": [
            {
                "identifier": "GO:0016757",
                "name": "glycosyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6a47bda1daaa1ee01d682b5ff075f7c38c72fa06",
        "counters": {
            "domain_architectures": 11614,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 11614
        }
    }
}