General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3QUL0",
        "id": "A0A6P3QUL0_PTEVA",
        "source_organism": {
            "taxId": "132908",
            "scientificName": "Pteropus vampyrus",
            "fullName": "Pteropus vampyrus (Large flying fox)"
        },
        "name": "All trans-polyprenyl-diphosphate synthase PDSS1",
        "description": [
            "Heterotetrameric enzyme that catalyzes the condensation of farnesyl diphosphate (FPP), which acts as a primer, and isopentenyl diphosphate (IPP) to produce prenyl diphosphates of varying chain lengths and participates in the determination of the side chain of ubiquinone. Supplies nona and decaprenyl diphosphate, the precursors for the side chain of the isoprenoid quinones ubiquinone-9 (Q9)and ubiquinone-10 (Q10) respectively. The enzyme adds isopentenyl diphosphate molecules sequentially to farnesyl diphosphate with trans stereochemistry"
        ],
        "length": 365,
        "sequence": "MSYFNLVKSLTAAFPNMYTISRLYHATSATCCCSKTRSGEKYTDPFKLGRRDLKGLYEDIRKELFISTTELKEMSEYYFDGKGKAFRPIIVVLMARACNIHYNNSRDVQASQRSIALIAEMIHTASLVHDDVIDDASSRRGKRTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVRGEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHEIAYQYGKNVGIAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFACRQFPEMNAMIMRRFSLPGDVDRARQYVLQSDGVQQTTYLAQRYCHEAIREISKLRPSRERDALIQLSETVLTRDK",
        "proteome": "UP000515202",
        "gene": "PDSS1",
        "go_terms": [
            {
                "identifier": "GO:0004659",
                "name": "prenyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008299",
                "name": "isoprenoid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7d86fa062ed092e18d33fa27312ed76ddc71a30e",
        "counters": {
            "domain_architectures": 84087,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "sfld": 1,
                "prosite": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 84087
        }
    }
}