GET /api/protein/UniProt/A0A6P3QQU1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3QQU1",
"id": "A0A6P3QQU1_PTEVA",
"source_organism": {
"taxId": "132908",
"scientificName": "Pteropus vampyrus",
"fullName": "Pteropus vampyrus (Large flying fox)"
},
"name": "Appetite-regulating hormone",
"description": [
"Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation",
"Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility"
],
"length": 117,
"sequence": "MPSLGTICSLLLLSVLWVDLAMAGSSFLSPEHQKVQQRKESKKPPVKLQPRELKGWLRPEDGSQAEAAEDELKIRFNTPFDVGIKLSGAQDRRPGQVLEKFLQDVLWEEASEVLADK",
"proteome": "UP000515202",
"gene": "GHRL",
"go_terms": [
{
"identifier": "GO:0016608",
"name": "growth hormone-releasing hormone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005179",
"name": "hormone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "79b597a78df8c12991d4b42cf1c5ee5883a17c75",
"counters": {
"domain_architectures": 730,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 2,
"prints": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 730
}
}
}