General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3QPG1",
        "id": "A0A6P3QPG1_PTEVA",
        "source_organism": {
            "taxId": "132908",
            "scientificName": "Pteropus vampyrus",
            "fullName": "Pteropus vampyrus (Large flying fox)"
        },
        "name": "Isocitrate dehydrogenase [NAD] subunit, mitochondrial",
        "description": [
            "Plays a structural role to facilitate the assembly and ensure the full activity of the enzyme catalyzing the decarboxylation of isocitrate (ICT) into alpha-ketoglutarate. The heterodimer composed of the alpha (IDH3A) and beta (IDH3B) subunits and the heterodimer composed of the alpha (IDH3A) and gamma (IDH3G) subunits, have considerable basal activity but the full activity of the heterotetramer (containing two subunits of IDH3A, one of IDH3B and one of IDH3G) requires the assembly and cooperative function of both heterodimers"
        ],
        "length": 387,
        "sequence": "MAALSCARWLTRAVVAAPNPWAWRSLCTSAVAHAALRNQSQAEDVRVEGAFPVTMLPGDGVGPELMHAVKEVFKAACVPVEFQEHYLSEVQNMASEEKLEQVLSSMKENKVAIIGKIHTPMEYKGELASYDMRLRRKLDLFANVVHVKSLPGYMTRHNNLDLVIIREQTEGEYSSLEHESARGVIECLKIVTRTKSQRIAKFAFDYATKKGRDKVTAVHKANIMKLGDGLFLQCCEEVAELYPKIKFETMIIDNCCMQLVQNPYQFDVLVMPNLYGNIIDNLAAGLVGGAGVVPGESYSAEYAVFEMGARHPFAQAVGRNIANPTAMLLSASNMLRHLNLEYHSNMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLHPYGA",
        "proteome": "UP000515202",
        "gene": "IDH3B",
        "go_terms": [
            {
                "identifier": "GO:0006099",
                "name": "tricarboxylic acid cycle",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000287",
                "name": "magnesium ion binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016616",
                "name": "oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0051287",
                "name": "NAD binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "c0dd027c099af1b1fcd3352f0b400bd0f7d5c9c5",
        "counters": {
            "domain_architectures": 89688,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 89688
        }
    }
}