GET /api/protein/UniProt/A0A6P3QE99/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3QE99",
"id": "A0A6P3QE99_PTEVA",
"source_organism": {
"taxId": "132908",
"scientificName": "Pteropus vampyrus",
"fullName": "Pteropus vampyrus (Large flying fox)"
},
"name": "Fibroblast growth factor",
"description": [
"Plays an important role in the regulation of cell proliferation and cell differentiation. Required for normal regulation of the hair growth cycle. Functions as an inhibitor of hair elongation by promoting progression from anagen, the growth phase of the hair follicle, into catagen the apoptosis-induced regression phase"
],
"length": 269,
"sequence": "MSLSFLLLFLSHLILSAWAHGEKRLAPKGQSGPSATDRNPGGASSRRSSSTTTSSSSSSASSSPSASLGSQGSGLEQSSFQWTPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEASMLSILEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKKPPNPIKPKVPLSAPRKNPNTVKYRLKFRFG",
"proteome": "UP000515202",
"gene": "FGF5",
"go_terms": [
{
"identifier": "GO:0008083",
"name": "growth factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "5171d0377b6deb31d3e4658b327f83b114bedf70",
"counters": {
"domain_architectures": 24103,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"prints": 2,
"prosite": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 24103
}
}
}