GET /api/protein/UniProt/A0A6P3IUC3/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3IUC3",
        "id": "A0A6P3IUC3_BISBB",
        "source_organism": {
            "taxId": "43346",
            "scientificName": "Bison bison bison",
            "fullName": "Bison bison bison (North American plains bison)"
        },
        "name": "Beta-1 adrenergic receptor",
        "description": [
            "Beta-adrenergic receptors mediate the catecholamine-induced activation of adenylate cyclase through the action of G proteins. This receptor binds epinephrine and norepinephrine with approximately equal affinity. Mediates Ras activation through G(s)-alpha- and cAMP-mediated signaling. Involved in the regulation of sleep/wake behaviors"
        ],
        "length": 358,
        "sequence": "CNLSSAAPVPDGAATAARLLVPASPPASLLTSASEGPPLPSQQWTAGMGLLMAFIVLLIVAGNVLVIVAIAKTPRLQTLTNLFIMSLASADLVMGLLVVPFGATIVVWGRWEYGSFFCELWTSVDVLCVTASIETLCVIALDRYLAITSPFRYQSLLTRARARALVCTVWAISALVSFLPIFMQWWRDKDAKASGCYNDPECCDFIINEGYAITSSVVSFYVPLCIMAFVYLRVFREAQKQVKKIDSCERRFLSGPARLPSPAPSPGPPLPAXTTVANGRANKRRPSRLVALREQKALKTLGIIASDDDDDDDEDDVGAAPPVRLLEPWAGYNGGAAANSDSSPDESSRAGCASESKV",
        "proteome": "UP000515208",
        "gene": "ADRB1",
        "go_terms": [
            {
                "identifier": "GO:0004930",
                "name": "G protein-coupled receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007186",
                "name": "G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0004940",
                "name": "beta1-adrenergic receptor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0007189",
                "name": "adenylate cyclase-activating G protein-coupled receptor signaling pathway",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045823",
                "name": "positive regulation of heart contraction",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": true,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "587fa3dbe4504dc051049f3cca904dd9ab631b87",
        "counters": {
            "domain_architectures": 394800,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "profile": 1,
                "panther": 1,
                "prosite": 1,
                "prints": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 394800
        }
    }
}