HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3I3Z3",
"id": "A0A6P3I3Z3_BISBB",
"source_organism": {
"taxId": "43346",
"scientificName": "Bison bison bison",
"fullName": "Bison bison bison (North American plains bison)"
},
"name": "[Pyruvate dehydrogenase [acetyl-transferring]]-phosphatase 2, mitochondrial",
"description": [
"Mitochondrial enzyme that catalyzes the dephosphorylation and concomitant reactivation of the alpha subunit of the E1 component of the pyruvate dehydrogenase complex (PDC), thereby stimulating the conversion of pyruvate into acetyl-CoA. Acts as a crucial regulator of T cell metabolism and function, with a particular focus on T-helper Th17"
],
"length": 531,
"sequence": "MSSTVSYWILSSARKTIATLQGGQRLYSRYASNRSKSKWRLCPQGQATLKDNATACGGIALQKAYRHTSTEEEDFHLQLSPEQVNEVLRAGESAHKILDLVSRAPDSVLRFESNQLAANSPVEDRGGIAACLQTNGLLFGIFDGHGGHACAQAVSERLFYYVAVSLMSQQTLEQMEEAMESMKPLLPILQWLKHPGDSIYKDVTSVHLDHLRVYWQELLNLHMEMGLSTEEALMYSFQRLDSDISLEIQAPLEDEMTRNLSLQVAFSGATACLAHVDGVHLHVANAGDCRAILGVQEDNGMWSCLPLTQDHNAWNPAELSRLKREHPESEDRTVIMENRLLGVLMPCRAFGDVQLKWSKELQRSVLERGFDTEALNIYQFTPPHYYTPPYLTARPEVTYHRLRPQDKFLVLASDGLWDVLGNEDVVRLVVEHLAEEGQHKPDLAQRPTNLGLMQGLLQQRKAQGLHAADQNAATRLIRYAIGNNEYGEMEPERLSAMLTLPEDLARMYRDDITVTVVYFNSDSIGASSKGS",
"proteome": "UP000515208",
"gene": "PDP2",
"go_terms": [
{
"identifier": "GO:0004722",
"name": "protein serine/threonine phosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006470",
"name": "protein dephosphorylation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0043169",
"name": "cation binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "9761dfa8fcbc09f23441e5fd2f8dffed523952dd",
"counters": {
"domain_architectures": 75992,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"smart": 1,
"profile": 1,
"cdd": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 75992
}
}
}