GET /api/protein/UniProt/A0A6P3HKZ5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3HKZ5",
"id": "A0A6P3HKZ5_BISBB",
"source_organism": {
"taxId": "43346",
"scientificName": "Bison bison bison",
"fullName": "Bison bison bison (North American plains bison)"
},
"name": "lysozyme",
"description": [
"Lysozymes have primarily a bacteriolytic function; those in tissues and body fluids are associated with the monocyte-macrophage system and enhance the activity of immunoagents"
],
"length": 166,
"sequence": "MLNSKSSSPGQLGHLASVNMKALLILGLLLLSVAVQGKTFERCELARTLKKLGLAGYKGVSLANWMCLAKGESGYNTQAKNYSPGFKSTDYGIFQINSKWWCNDGKTPKAVNGCGVSCSALLKDDITQAVACAKKIVSQQGLTAWVAWKNKCRNRDLTSYVKGCGV",
"proteome": "UP000515208",
"gene": "LOC104989758",
"go_terms": [
{
"identifier": "GO:0003796",
"name": "lysozyme activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "8e5cd5fbc85aab31b038436e245dc494a1f9c477",
"counters": {
"domain_architectures": 5640,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"ssf": 1,
"smart": 1,
"profile": 1,
"panther": 1,
"prints": 2,
"prosite": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5640
}
}
}