HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3H9B3",
"id": "A0A6P3H9B3_BISBB",
"source_organism": {
"taxId": "43346",
"scientificName": "Bison bison bison",
"fullName": "Bison bison bison (North American plains bison)"
},
"name": "Thioredoxin domain-containing protein",
"description": [
"Copper metallochaperone essential for the synthesis and maturation of cytochrome c oxidase subunit II (MT-CO2/COX2) by facilitating the incorporation of copper into the Cu(A) site of MT-CO2/COX2"
],
"length": 266,
"sequence": "MLLLARAPKAWHRLFQLQPLALPGTPGGKTQHVRYQLFSTPGPADTGRQGQPQGPGLRTRLLVTALVGAGLGGAWLALRAEKERGRQQQRTEALRQAAVGQGEFSLLDHRGQVRCKADFRGQWVLLYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPLFITVDPERDTVAAMARYVQDFHPRLLGLTGSTEQIAQVSRSYRVYYSAGPKDEDQDYIVDHSIAIYLLSPDGLFTDYYSRARSAEQITDSVRRHMAAFRSVLR",
"proteome": "UP000515208",
"gene": "LOC104989733",
"go_terms": [
{
"identifier": "GO:0005507",
"name": "copper ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016531",
"name": "copper chaperone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006878",
"name": "intracellular copper ion homeostasis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008535",
"name": "respiratory chain complex IV assembly",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005743",
"name": "mitochondrial inner membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "da343d963f8063a008fd2c213e29f6ebf796e592",
"counters": {
"domain_architectures": 30203,
"entries": 11,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"panther": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 30203
}
}
}