GET /api/protein/UniProt/A0A6P3GRB2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3GRB2",
        "id": "A0A6P3GRB2_BISBB",
        "source_organism": {
            "taxId": "43346",
            "scientificName": "Bison bison bison",
            "fullName": "Bison bison bison (North American plains bison)"
        },
        "name": "Adenylosuccinate lyase",
        "description": [
            "Catalyzes two non-sequential steps in de novo AMP synthesis: converts (S)-2-(5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamido)succinate (SAICAR) to fumarate plus 5-amino-1-(5-phospho-D-ribosyl)imidazole-4-carboxamide, and thereby also contributes to de novo IMP synthesis, and converts succinyladenosine monophosphate (SAMP) to AMP and fumarate"
        ],
        "length": 490,
        "sequence": "MAAAGDRGGREAACGHDSYRSPLASRYASPEMCFLFSDKYKFRTWRQLWLWLAEAEQTLGLPITDEQIQEMKSNLDNIDFRMAAEEEKQLRHDVMAHVHTFAHCCPKAASIIHLGATSCYVGDNTDLIILRNAFDLLLPKLARVISRLADFAKEQADLPTLGFTHFQPAQLTTVGKRCCLWIQDLCMDLQNLKRVRDELRFRGVKGTTGTQASFLQLFEGDDQKVEQLDKMVTEKAGFKRAFIITGQTYTRKVDIEVLSVLASLGASVHKICTDIRLLANLKEMEEPFEKQQIGSSAMPYKRNPMRSERCCSLARHLMALVMDPLQTASVQWFERTLDDSANRRICLAEAFLTADTVLNTLQNISEGLVVYPKVIERRVRQELPFMATENVIMAMVKAGGNRQDCHEKIRVLSQQAAAVVKQEGGDNDLIERIQADAYFSPIHSQLDHLLDPSSFTGRASQQVQRFLEEEVCPLLKPYESVMKVKAELCL",
        "proteome": "UP000515208",
        "gene": "ADSL",
        "go_terms": [
            {
                "identifier": "GO:0003824",
                "name": "catalytic activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004018",
                "name": "N6-(1,2-dicarboxyethyl)AMP AMP-lyase (fumarate-forming) activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0009152",
                "name": "purine ribonucleotide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4aa296ce872e7f1f3b85130edf14bb8eaf8f3c83",
        "counters": {
            "domain_architectures": 23990,
            "entries": 19,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 3,
                "pfam": 2,
                "smart": 1,
                "panther": 1,
                "ncbifam": 1,
                "prints": 2,
                "prosite": 1,
                "interpro": 6
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 23990
        }
    }
}