HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3FUW1",
"id": "A0A6P3FUW1_OCTDE",
"source_organism": {
"taxId": "10160",
"scientificName": "Octodon degus",
"fullName": "Octodon degus (Degu)"
},
"name": "Diacylglycerol kinase",
"description": [
"Membrane-bound diacylglycerol kinase that converts diacylglycerol/DAG into phosphatidic acid/phosphatidate/PA and regulates the respective levels of these two bioactive lipids. Thereby, acts as a central switch between the signaling pathways activated by these second messengers with different cellular targets and opposite effects in numerous biological processes. Also plays an important role in the biosynthesis of complex lipids. Displays specificity for diacylglycerol substrates with an arachidonoyl acyl chain at the sn-2 position, with the highest activity toward 1-octadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycerol the main diacylglycerol intermediate within the phosphatidylinositol turnover cycle. Can also phosphorylate diacylglycerol substrates with a linoleoyl acyl chain at the sn-2 position but much less efficiently"
],
"length": 575,
"sequence": "MDGERRPAPGPPAQGLLADEHLVLWTLCSVLLPVFITFWCSLQRSRRQLHRRDIFRKSKHGWRDTDLFSQPTYCCVCAQHILQGAFCDCCGLRVDEGCLKKADKRFQCKEIMLKSDTRALDAMPHHWIRGNVPLCSYCVLCRQQCGTQPKLCDYRCVWCQKTVHDECMKNSLRNEKCDFGEFKSLIIPPSYITAVNQMRKNKKTDYEVLASKFGQQWTPLIILANSRSGTNMGEGLLGEFRILLNPVQVFDVTKTPPIKALQICTLLPCYSARVLVCGGDGTVGWVLDAVDEMKIKGQEKYIPQVAVLPLGTGNDLSNTLGWGAGYAGEIPVAQVLRNVMEADGIKLDRWKVQVTNKGYYSLRKPKEFTMNNYFSVGPDALMALNFHVHREKAPSLFSSRILNKAVYLFYGTKDCLVQECKDLNKKVELELDGERVELPNLEGIIVLNIGYWGGGCRLWEGMGDETYPLARHDDGLLEVVGVYGSFHCAQIQVKLANPFRIGQAHTVRLILKCSMMPMQVDGEPWAQGPCTVTITHKTRALMLYFSGEQTDDDISSASDQEDEKEAEYTDEDVQM",
"proteome": "UP000515203",
"gene": "Dgke",
"go_terms": [
{
"identifier": "GO:0016301",
"name": "kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004143",
"name": "ATP-dependent diacylglycerol kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0007200",
"name": "phospholipase C-activating G protein-coupled receptor signaling pathway",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0007165",
"name": "signal transduction",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "472583803b7c94d82c965a6c52771eb235e476cf",
"counters": {
"domain_architectures": 2572,
"entries": 24,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 2,
"smart": 3,
"profile": 2,
"ssf": 2,
"pfam": 3,
"cathgene3d": 3,
"panther": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 2572
}
}
}