GET /api/protein/UniProt/A0A6P3FT62/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3FT62",
"id": "A0A6P3FT62_OCTDE",
"source_organism": {
"taxId": "10160",
"scientificName": "Octodon degus",
"fullName": "Octodon degus (Degu)"
},
"name": "Carotenoid-cleaving dioxygenase, mitochondrial",
"description": [
"Broad specificity mitochondrial dioxygenase that mediates the asymmetric oxidative cleavage of carotenoids. Cleaves carotenes (pure hydrocarbon carotenoids) such as all-trans-beta-carotene and lycopene as well as xanthophylls (oxygenated carotenoids) such as zeaxanthin, lutein and beta-cryptoxanthin at both the 9,10 and the 9',10' carbon-carbon double bond. Through its function in carotenoids metabolism regulates oxidative stress and the production of important signaling molecules"
],
"length": 574,
"sequence": "MFSPNFHRFLSNLSATSVSFLSLRARRFPVLKKCMMYTEKRANLGQQRSLPCIAPLLTTVEETPHTISARVQGNIPKWLNGYLLRVGPGKFEFGKDKYNHWFDGMALLHQFKIEKGTVTYRSKFLQSDTYLTNSAQNRIIISEFGTLALPDPCKNIFQRFMSRFETPTMTDNTSVNYVQYKGDYYMSTETNFMNKVDIETLEKTEKVDWRKFIAVNGATAHPHYDPDGTVYNMGNSYGPQGSYYNVIRVPPEKVDLGETLHGAQVICSIASTEKMKPSYYHSFGMTKNYIVFIEQPFKMNLWKIVTSKIRGKAFSDGISWEPQYNTRFHVVDKHTGQLLPGMYYSKPFVSFHQINAFEDQGCIVMDLCCQDDGRSLDVYQLQNLRKAGEGLDQVYNSMARSFPRRFVLPLDISVNAAEGETLSPLSYSSASAVKQADGKIWCVHENLHHEDLEEEGGIEFPQINYGQFSGKKYHFFYGCGFRHLVGDSLIKVDVVNKTLKVWRKDGFYPSEPVFVPVPGKQEEDAGVILSVVITANQNESNFLLILDASTFEELGRAEVPVQMPYGFHGTFVPL",
"proteome": "UP000515203",
"gene": "Bco2",
"go_terms": [
{
"identifier": "GO:0016702",
"name": "oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d98bee20ce1085859dbded542e56e7cc91a5840c",
"counters": {
"domain_architectures": 25825,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 1,
"panther": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 25825
}
}
}