General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3FT62",
        "id": "A0A6P3FT62_OCTDE",
        "source_organism": {
            "taxId": "10160",
            "scientificName": "Octodon degus",
            "fullName": "Octodon degus (Degu)"
        },
        "name": "Carotenoid-cleaving dioxygenase, mitochondrial",
        "description": [
            "Broad specificity mitochondrial dioxygenase that mediates the asymmetric oxidative cleavage of carotenoids. Cleaves carotenes (pure hydrocarbon carotenoids) such as all-trans-beta-carotene and lycopene as well as xanthophylls (oxygenated carotenoids) such as zeaxanthin, lutein and beta-cryptoxanthin at both the 9,10 and the 9',10' carbon-carbon double bond. Through its function in carotenoids metabolism regulates oxidative stress and the production of important signaling molecules"
        ],
        "length": 574,
        "sequence": "MFSPNFHRFLSNLSATSVSFLSLRARRFPVLKKCMMYTEKRANLGQQRSLPCIAPLLTTVEETPHTISARVQGNIPKWLNGYLLRVGPGKFEFGKDKYNHWFDGMALLHQFKIEKGTVTYRSKFLQSDTYLTNSAQNRIIISEFGTLALPDPCKNIFQRFMSRFETPTMTDNTSVNYVQYKGDYYMSTETNFMNKVDIETLEKTEKVDWRKFIAVNGATAHPHYDPDGTVYNMGNSYGPQGSYYNVIRVPPEKVDLGETLHGAQVICSIASTEKMKPSYYHSFGMTKNYIVFIEQPFKMNLWKIVTSKIRGKAFSDGISWEPQYNTRFHVVDKHTGQLLPGMYYSKPFVSFHQINAFEDQGCIVMDLCCQDDGRSLDVYQLQNLRKAGEGLDQVYNSMARSFPRRFVLPLDISVNAAEGETLSPLSYSSASAVKQADGKIWCVHENLHHEDLEEEGGIEFPQINYGQFSGKKYHFFYGCGFRHLVGDSLIKVDVVNKTLKVWRKDGFYPSEPVFVPVPGKQEEDAGVILSVVITANQNESNFLLILDASTFEELGRAEVPVQMPYGFHGTFVPL",
        "proteome": "UP000515203",
        "gene": "Bco2",
        "go_terms": [
            {
                "identifier": "GO:0016702",
                "name": "oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d98bee20ce1085859dbded542e56e7cc91a5840c",
        "counters": {
            "domain_architectures": 25825,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 1,
                "panther": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25825
        }
    }
}