GET /api/protein/UniProt/A0A6P3F020/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3F020",
        "id": "A0A6P3F020_OCTDE",
        "source_organism": {
            "taxId": "10160",
            "scientificName": "Octodon degus",
            "fullName": "Octodon degus (Degu)"
        },
        "name": "THAP domain-containing protein 1",
        "description": [
            "DNA-binding transcription regulator that regulates endothelial cell proliferation and G1/S cell-cycle progression. Specifically binds the 5'-[AT]NTNN[GT]GGCA[AGT]-3' core DNA sequence and acts by modulating expression of pRB-E2F cell-cycle target genes"
        ],
        "length": 212,
        "sequence": "MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKQWEAAVRRKNFKPTKYSSICSEHFTPDCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLEPQEQLPPPPSTPPISQVDAAIGLLMPPLQTPDNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLVKLKEVVHFQKEKDDVSERGYVILPNDIFEIVEVPA",
        "proteome": "UP000515203",
        "gene": "Thap1",
        "go_terms": [
            {
                "identifier": "GO:0043565",
                "name": "sequence-specific DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d0643f96eba1dfa30941482fd5309ac69166bce7",
        "counters": {
            "domain_architectures": 21492,
            "entries": 10,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "smart": 2,
                "pfam": 1,
                "cathgene3d": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 21492
        }
    }
}