GET /api/protein/UniProt/A0A6P3DW82/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3DW82",
        "id": "A0A6P3DW82_BOMIM",
        "source_organism": {
            "taxId": "132113",
            "scientificName": "Bombus impatiens",
            "fullName": "Bombus impatiens (Bumblebee)"
        },
        "name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1",
        "description": [
            "Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity"
        ],
        "length": 111,
        "sequence": "MTALTVIAKFWQEYTKSTPKKLKIIDAYLLYVFLTGAIQFVYCCLVGTFPFNSFLSGFISCVSCFVLGVCLRLQVNPQNKSQFHGISPERGFADFIFAHVILHIVVMNFIG",
        "proteome": "UP000515180",
        "gene": "LOC100744147",
        "go_terms": [
            {
                "identifier": "GO:0008250",
                "name": "oligosaccharyltransferase complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "0b5c0e8a11427f4461e6f428a8ec0d6d1d9af5d9",
        "counters": {
            "domain_architectures": 4125,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4125
        }
    }
}