GET /api/protein/UniProt/A0A6P3DW82/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3DW82",
"id": "A0A6P3DW82_BOMIM",
"source_organism": {
"taxId": "132113",
"scientificName": "Bombus impatiens",
"fullName": "Bombus impatiens (Bumblebee)"
},
"name": "Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1",
"description": [
"Subunit of the oligosaccharyl transferase (OST) complex that catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains, the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are required for a maximal enzyme activity"
],
"length": 111,
"sequence": "MTALTVIAKFWQEYTKSTPKKLKIIDAYLLYVFLTGAIQFVYCCLVGTFPFNSFLSGFISCVSCFVLGVCLRLQVNPQNKSQFHGISPERGFADFIFAHVILHIVVMNFIG",
"proteome": "UP000515180",
"gene": "LOC100744147",
"go_terms": [
{
"identifier": "GO:0008250",
"name": "oligosaccharyltransferase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0016020",
"name": "membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0b5c0e8a11427f4461e6f428a8ec0d6d1d9af5d9",
"counters": {
"domain_architectures": 4125,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4125
}
}
}