HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P3DP50",
"id": "A0A6P3DP50_BOMIM",
"source_organism": {
"taxId": "132113",
"scientificName": "Bombus impatiens",
"fullName": "Bombus impatiens (Bumblebee)"
},
"name": "Cytoplasmic tRNA 2-thiolation protein 1",
"description": [
"Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position"
],
"length": 343,
"sequence": "MPIPCSKQCGKGAILKRPKTGHALCKECFFYAFESEIHNTITQGKLFKPGDKVAIGASGGKDSTVLAYVLKTLNDRYQYGIDLFLLSIDEGITGYRDDSLKTVQQNKDDYGLPLKILSYKELYGWTMDEIVAEIGKKNNCTFCGVFRRQALDRGAALLEVDCIATGHNADDIAETVLMNILRGDIARLQRCTSVITAGADCIRRCKPLKYAYEKEIVMYAYFKQLIYFSTECIYAPNAYRGHARTYLKDLEKIRPSSILDIIHSGETLQIKESIKLPEQRNCSRCGFVSSQEICKACIMLEGLNRGLPKLGIGKSTKVKRVIDSTTNDKCKNNEKTKLKNLEF",
"proteome": "UP000515180",
"gene": "LOC100747993",
"go_terms": [
{
"identifier": "GO:0000049",
"name": "tRNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0002098",
"name": "tRNA wobble uridine modification",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0034227",
"name": "tRNA thio-modification",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008033",
"name": "tRNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "ecea3fd540da2a3be05a58e475a5fac2d5801c14",
"counters": {
"domain_architectures": 3042,
"entries": 17,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"cdd": 1,
"ssf": 1,
"pfam": 2,
"hamap": 1,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"prosite": 1,
"interpro": 7
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3042
}
}
}