GET /api/protein/UniProt/A0A6P3DP50/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P3DP50",
        "id": "A0A6P3DP50_BOMIM",
        "source_organism": {
            "taxId": "132113",
            "scientificName": "Bombus impatiens",
            "fullName": "Bombus impatiens (Bumblebee)"
        },
        "name": "Cytoplasmic tRNA 2-thiolation protein 1",
        "description": [
            "Plays a central role in 2-thiolation of mcm(5)S(2)U at tRNA wobble positions of tRNA(Lys), tRNA(Glu) and tRNA(Gln). Directly binds tRNAs and probably acts by catalyzing adenylation of tRNAs, an intermediate required for 2-thiolation. It is unclear whether it acts as a sulfurtransferase that transfers sulfur from thiocarboxylated URM1 onto the uridine of tRNAs at wobble position"
        ],
        "length": 343,
        "sequence": "MPIPCSKQCGKGAILKRPKTGHALCKECFFYAFESEIHNTITQGKLFKPGDKVAIGASGGKDSTVLAYVLKTLNDRYQYGIDLFLLSIDEGITGYRDDSLKTVQQNKDDYGLPLKILSYKELYGWTMDEIVAEIGKKNNCTFCGVFRRQALDRGAALLEVDCIATGHNADDIAETVLMNILRGDIARLQRCTSVITAGADCIRRCKPLKYAYEKEIVMYAYFKQLIYFSTECIYAPNAYRGHARTYLKDLEKIRPSSILDIIHSGETLQIKESIKLPEQRNCSRCGFVSSQEICKACIMLEGLNRGLPKLGIGKSTKVKRVIDSTTNDKCKNNEKTKLKNLEF",
        "proteome": "UP000515180",
        "gene": "LOC100747993",
        "go_terms": [
            {
                "identifier": "GO:0000049",
                "name": "tRNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0002098",
                "name": "tRNA wobble uridine modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0034227",
                "name": "tRNA thio-modification",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0008033",
                "name": "tRNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ecea3fd540da2a3be05a58e475a5fac2d5801c14",
        "counters": {
            "domain_architectures": 3042,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 2,
                "hamap": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "prosite": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3042
        }
    }
}