HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "A0A6P2CS80",
"id": "A0A6P2CS80_9BACT",
"source_organism": {
"taxId": "1210884",
"scientificName": "Gemmata massiliana",
"fullName": "Gemmata massiliana"
},
"name": "Adenosine 5'-phosphosulfate reductase",
"description": [
"Catalyzes the formation of sulfite from adenosine 5'-phosphosulfate (APS) using thioredoxin as an electron donor"
],
"length": 243,
"sequence": "MSVQQATTEEIAEANERLRTASPQTVLQWAAERFHPRLLMATAFGAEGCCIIHMLAEIQPATTVINLDTGYQFPETLELRERIKDKYGIEVEYIRPELTVTEYEAEHGGPLYSHRPDQCCYDRKILPLRLAVERIAPLAWISAIRKDQTTDRGKAEVVQWDTKFNLVKVNPLLNWTKKDVWGFIHKNDVPYNPLHDRDYPSIGCWPCTRPVAAGEDDRAGRWAGKVKKECGLHVIEVKDGEGI",
"proteome": "UP000464178",
"gene": "cysH",
"go_terms": [
{
"identifier": "GO:0003824",
"name": "catalytic activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004604",
"name": "phosphoadenylyl-sulfate reductase (thioredoxin) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0019379",
"name": "sulfate assimilation, phosphoadenylyl sulfate reduction by phosphoadenylyl-sulfate reductase (thioredoxin)",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7eeef8759c43c36f2f8a365b1ed067ea1b563441",
"counters": {
"domain_architectures": 44311,
"entries": 12,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"ncbifam": 2,
"pirsf": 1,
"panther": 1,
"hamap": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 44311
}
}
}