General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "A0A6P1M021",
        "id": "A0A6P1M021_9BACT",
        "source_organism": {
            "taxId": "2697043",
            "scientificName": "Tichowtungia aerotolerans",
            "fullName": "Tichowtungia aerotolerans"
        },
        "name": "DNA polymerase IV",
        "description": [
            "Poorly processive, error-prone DNA polymerase involved in untargeted mutagenesis. Copies undamaged DNA at stalled replication forks, which arise in vivo from mismatched or misaligned primer ends. These misaligned primers can be extended by PolIV. Exhibits no 3'-5' exonuclease (proofreading) activity. May be involved in translesional synthesis, in conjunction with the beta clamp from PolIII"
        ],
        "length": 399,
        "sequence": "MLQRTILHVDMDAFFAAIEQHDRPELKGLPVVVGSPRDRRGVVSTCSYEARKYGIHSAMPSRTAAQRCPQAVFLPVRMARYQEVSRQIMQVFENFTPYVQPLSCDEAFLDVTGAIRLFGDGPTIAKKIKAAILEQTGLTCSIGVAPNPFLAKIASDMNKPDGLTVVPFSEKLIPAFLAPLPIKRMWGAGGKTQAILKSHNIHTIGDLQKTDPQQLAKWIGENAASSFRRRAFGIDERPIETDTEEKSISNEITFPEDTANADQIEQCLLDLADKVGRRLRKAGYYAATAQIKVRWKDFSTITRQRRLDPVCCDDITLRETAMELLKKEGLHSPVRLIGFGVSGLRETADSPQLDLFQSPEKQTSKKREALSRAVDAVRSKFGTNSLRRGSSIESRKLDP",
        "proteome": "UP000464954",
        "gene": "dinB",
        "go_terms": [
            {
                "identifier": "GO:0006281",
                "name": "DNA repair",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003887",
                "name": "DNA-directed DNA polymerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003684",
                "name": "damaged DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "8b74aa26b7c9e9a53734af6e2bae4a3adfbc28a1",
        "counters": {
            "domain_architectures": 14230,
            "entries": 22,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 4,
                "profile": 1,
                "cdd": 1,
                "pfam": 3,
                "panther": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 8
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 14230
        }
    }
}